PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009797929.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 132aa    MW: 15073.5 Da    PI: 8.2067
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009797929.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.11.9e-271059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rienk+nrqvtfsk + g+ KKA+E+SvLCdaeva+i+fs++gkl++yss
  XP_009797929.1 10 RIENKINRQVTFSKMKGGLVKKAHEISVLCDAEVALIVFSHKGKLFDYSS 59
                    8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.0E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.614161IPR002100Transcription factor, MADS-box
CDDcd002651.09E-36273No hitNo description
SuperFamilySSF554552.88E-30276IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MGRGKVELRR IENKINRQVT FSKMKGGLVK KAHEISVLCD AEVALIVFSH KGKLFDYSSD  60
SCLTDTIDVY FNYGGEWVIS PEVLYNKRLV HIWNKFDPDL LSYKDLREEF TKELGFIEVK  120
QLLVVGLSGG SI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J5e-19295189Myocyte-specific enhancer factor 2A
3p57_I5e-19295189Myocyte-specific enhancer factor 2A
3p57_D5e-19295189Myocyte-specific enhancer factor 2A
3p57_C5e-19295189Myocyte-specific enhancer factor 2A
3p57_B5e-19295189Myocyte-specific enhancer factor 2A
3p57_A5e-19295189Myocyte-specific enhancer factor 2A
3kov_J5e-19295189Myocyte-specific enhancer factor 2A
3kov_I5e-19295189Myocyte-specific enhancer factor 2A
3kov_B5e-19295189Myocyte-specific enhancer factor 2A
3kov_A5e-19295189Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009797929.15e-93PREDICTED: truncated transcription factor CAULIFLOWER D-like
SwissprotD7KWY62e-37AP1_ARALL; Floral homeotic protein APETALA 1
SwissprotP356313e-37AP1_ARATH; Floral homeotic protein APETALA 1
TrEMBLA0A078JJ531e-35A0A078JJ53_BRANA; BnaA02g35830D protein
TrEMBLM4FB601e-35M4FB60_BRARP; Uncharacterized protein
STRINGBra038326.1-P3e-35(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.12e-38MIKC_MADS family protein